AI GOVERNANCE
- Addressing AI Bias in Maternal Healthcare in Southern Africa : An ethnographic research into the datasets powering maternal healthcare app “DawaMom” used across Zambia and other Southern African countries (LUSAKA,...
- Build in the Open: Funding the Future of Trustworthy Tech : Grounded by our own open source roots, Mozilla has long funded open source technologies that help to untangle thorny sociotechnical issues. From the M...
- Mozilla Expands Volunteer-led Push for Inclusive AI in Taiwanese Indigenous Languages : Mozilla’s Common Voice now features 60 hours of speech datasets in eight new Indigenous languages. Meet the Taiwan Language volunteers at RightsCon on...
- Build in the Open: Scouting Tech's Boldest Changemakers : For over a decade, Mozilla Fellowships have sought to nurture talent at the intersection of technology and society. Launched in 2011, our fellowships ...
- MozFest House Zambia 2024 Recap: A Celebration of Solidarity : MozFest House Zambia took place on November 20-21, 2024 at the Lusaka International Conference Center. Over 500 technologists, activists, funders, and...
- AI in Africa: Promise, Pitfalls, and Politics : At MozFest House Zambia, Skoll Foundation brought together technologists, policymakers, and activists who are implementing AI solutions on the contine...
- Common Voice 20 is Now Available : The Common Voice team is honoured to be able to announce that the 20th version of our multilingual, open speech dataset is now available. This dataset...
AI NEWS
- ‘The frontline is everywhere’: new MI6 head to warn of growing Russian threat
- Grok got crucial facts wrong about Bondi Beach shooting
- Build vs buy is dead — AI just killed it
- AI agents debate their way to improved mathematical reasoning
- An AI-Powered Toy Is Regaling Children With Chinese Communist Party Talking Points
- Trump Orders States Not to Protect Children From Predatory AI
- Reasoning models now ace all three CFA exam levels
- CHT blasts Trump's executive order for creating an AI accountability vacuum
- Deepmind co-founder Shane Legg sees 50 percent chance of "minimal AGI" by 2028
- LongCat-Image proves 6B parameters can beat bigger models with better data hygiene
- Adobe brings Photoshop, Acrobat, and Express directly to ChatGPT
- OpenAI drops equity waiting period to encourage risk-taking
- YouTube channels spreading fake, anti-Labour videos viewed 1.2bn times in 2025
- Nate Jones Gets AI Data Centers Wrong
- More AI agents isn't always better, new Google and MIT study finds
- Google's new live translation beta uses Gemini to preserve tone and rhythm
- Why Indian AI Startups Still Seek Validation from the West
- In Just 28 Days, OpenAI Built Sora’s Android App Using Codex
- People Are Already Creating Ghoulishly Horrifying Sora Disney Videos
- Why most enterprise AI coding pilots underperform (Hint: It's not the model)
AI RESEARCH
- A Comprehensive Guide on Fine-Tuning AI Models On Your Dataset For Beginners
- Introduction to Qwen3-VL
- All About Human in The Loop!
- Building an Agentic Resume Matcher: Python Foundations for GenAI
- A Hidden Line of Text Can Hijack an AI — No Clicks, No Malware, Just Words
- SAP Datasphere MCP server. Release blog
- 2025 Open Models Year in Review
- How Companies Can Start Building With AI (Without Breaking Everything)
- I Read OpenAI’s GPT‑5.2 Prompting Guide So You Don’t Have To
- The Linux Moment for AI Has Arrived: MCP, Agents, and the Linux AI Foundation
- They Taught AI to Speak Chinese Like a Human Using Video Game Logic
- Router-Based Agents: The Architecture Pattern That Makes AI Systems Scale
- AI finds a hidden stress signal inside routine CT scans
- AI Didn’t Break Your Security. It Just Moved Fast Enough to Show How Broken It Already Was
- Turn Your MySQL into an AI Knowledge Base Today
- The Sequence Radar #771: Last Week in AI: GPT-5.2, Mistral, and Google’s Agent Stack
- The Architecture of a Small LLM (Explained Like You’re 18)
- Data Scientists Don’t Need More Models — They Need Better Thinking
- Building Real AI Cloud Systems — Series 2, Part 1: Building a Real AI Cloud Agent — A…
- Part 4: Building a Real DevOps Agent — A Step-by-Step Tutorial
- I Watched AI Fail at Math Three Times. The Third Time Taught Me Something Nobody Teaches
- Building AI-Driven Forecasting Systems for Resilient Supply Chains
- Why Large Language Models Prove Language Is Not Intelligence
- Agentic AI in Fintech: How Autonomous Agents End “Click and Pray” Banking
- RAG Pipeline : A Complete Guide
- Serving Machine Learning Models as FastAPI Endpoints
- What Jailbreaking Actually Teaches Us About AI Consciousness
- Beyond the Screen: Inside Avinash Balachandran’s Vision for Human-Centered Embodied Intelligence
AI TOOLS
CLOUD BUSINESS
- 20+ useful Roku shortcuts and menus that every user should know about (and how to access them)
- The Real Bottleneck in Enterprise AI Isn’t the Model, It’s Context
- Fedora Silverblue Has a Handy Tool To Help Simplify Development
- Adafruit: Arduino’s Rules Are ‘Incompatible With Open Source’
- The 5 most innovative tech products that surprised us this year (including a first for robot vacs)
- Stop using your router's USB port - what PC experts recommend instead
- Three Core Principles for Sustainable Platform Design
CLOUD SECURITY
- How can Agentic AI enhance our cybersecurity measures
- How do I implement Agentic AI in financial services
- 2025: The Year Cybersecurity Crossed the AI Rubicon
- 2026 Will Be the Year of AI-based Cyberattacks – How Can Organizations Prepare?
- Why are companies free to choose their own AI-driven security solutions?
- Can Agentic AI provide solutions that make stakeholders feel assured?
CLOUD TECHNICAL
- Full-Stack Development: The AI Evolution
- Another E2E Solution delivered. This time with CI/CD, AWS EventBridge and ECS Fargate
- Beyond Coding: Your Accountability Buddy with Claude Code Skill
- Decisões demais, estratégia de menos
- 48 Hours to Learn AI Agents: How It Changed My View
- 2025-12-14 Daily Robotics News
- Creating an EC2 Instance
- Why Mathematics Is Essential in Machine Learning
- AWS Modulo 3: Lambda con Go
- Spotify Connect, Raspberry Pi, AirPlay & HomePod - because simple audio setups are boring
- Why Your AI-Generated Code is Probably Garbage (And How to Fix It)
- Managing Local and Remote Podman instances over LazyDocker
- Understanding Agentic AI: How Modern Systems Make Autonomous Decisions
- I Built an ML Platform to Monitor Africa's $700B Debt Crisis - Here's What I Learned
- # From Sailing to Smart Cities: My Year of Building Agents
- Rethinking Software Engineering: Why It Has Failed at Maintainability
- Title: I built a 13-app "Zoo" using Gemini Pro 3. The constraint: I wasn't allowed to inspect the code.
- When AI Writes Your Code, DevOps Becomes the Last Line of Defense
- Why Am I Not Making Progress Despite Solving LeetCode Daily? The Plateau Problem
- The Common Roadblocks for AI Storytelling
- Reinforcement Learning Environments: How AI Agents Learn Through Experience
- AWS Security Starter Pack: 5 Essential Tools
- What the AWS us-east-1 Outage Taught Me About Building Resilient Systems
- I built a SaaS for $0 in one weekend (LAMP Stack + Free Hosting). Here is what happened.
- What Is Agentforce Vibes? An Introduction to Salesforce Vibe Coding
- Best AI Meeting Note Taker for Smarter, Faster Meeting Documentation
- Bayesian Neural Networks Under Covariate Shift: When Theory Fails Practice
- Why VM-based obfuscation raises the cost of reversing JavaScript
- My Learning Journey – Google 5-Day AI Agents Intensive & Travel Multi-Agent System
- Reasons to optimize cloud costs (not just to save money)
- 👋 Starting My DevOps Journey!
- Building Yupcha: An AI Interview Platform for Scalable Hiring
- The hype cycle is exhausting. Every week brings a new model, a new benchmark, a new "everything has changed" moment. But here's what actually matters: AI is becoming a runtime for software. The winners won't be those who use the latest model,
- Stop Chasing Model Releases: The AI-Native Engineering Playbook for 2026
- Monetize Voice AI Solutions for eCommerce Using VAPI Effectively
- Brief summary of Agent intensive 5 days course
- Best Cursor Editor Themes 2024: Boost Focus & Reduce Eye Strain | Review
- We Evaluated 13 LLM Gateways for Production. Here's What We Found
- Meet TOON: A Token-First Data Format Built for AI
- From DNS to Containers: How AWS Routes Traffic Using Route 53 and Application Load Balancer
- Inside Google Jobs Series (Part 11): Cross-Domain & Payment Roles
- How to Build a Scalable RAG-Based Chatbot on AWS?
- Python Guide: How to Detect If a Domain Is a Scam
- Join the Microsoft 365 Developer Program
- Understanding AI, ML, DL, NLP, and Data Visualization: A Clear Guide for Beginners
- Blazor SaaS Starter Kits Compared: When to Choose Brick Starter for Full‑Stack C#
- PromptShield AI – An AI Cost & Risk Firewall Built with Xano
- Why Python Isn’t Enough: What Enterprises Miss When They Think of AI Only as a Data Science Problem
- From Confusion to Clarity: Building My First Research Agent in Google's AI Intensive
- The Complete Guide to Meta-Prompting: The Technique of Having AI Write Your Prompts
- Intelligent Multi-Agent Trip Planning System
- New AWS Lambda Durable Functions – Do they replace Step Functions?
- Orchestrating Creativity with Agentic AI: How I Built a Real Business Using Autonomous Agents
- From Beginner to Builder : How The AI Agent Intensive Course Changed My Understanding Of AI
- Python - Based Data Science Toolchain for Financial Market Trend Prediction
- How I Built a Daily Self-Love Journaling Habit That Actually Stuck (30-Day Framework)
- Cloud Computing Unveiled: A Beginner's Guide
- The Broke Student’s Guide to the Cloud: How I Host Projects for $0
- A Good Engineer Never Blames the Domain
- Building Better AI Prompts from Images: A Step-by-Step with Image2Prompts
- Lessons Learned: Choosing a Flink Distribution for Kubernetes (Bitnami vs Official)
- Making a WhatsApp Bot that Doesn't Suck (Node.js + GPT-5.2)
- MLOps: Data Science Lifecycle with DataSets examples, Workflows and Pipelines.
- Multi‑Tenant SaaS on .NET: Why a Starter Kit Beats Building from Scratch
- The End of Prompt Engineering: Entering the Era of Agent Control
- Why Focusing on People Still Matters in the Age of Artificial Intelligence
- Java Arrays clone() Explained: Deep Dive with Examples & Best Practices
- How Microsoft Agent Framework Can Boost Employee Training in 2026 and Beyond
- My Fingers Don’t Wait for My Brain — do yours?
- Kubernetes Just Retired the Ingress Everyone Thought Was “The Default”
- The Evolution of AI Surveillance
- Photovoltaic Geometry: Engineering Analysis of the Anker SOLIX PS200
- How We Cut SaaS Churn by 35% with a Simple, Event-Driven Engine
- Expose Local n8n with a Custom HTTPS Domain Using Cloudflare Tunnel
- Cashflow Insights — AI-Enhanced Backend with Xano
- HTML Tags That'll Make Your Life Easier (No, Really)
- I Built an AI Movie Recommendation App to End Endless Scrolling
- From Beginner to Builder: How the AI Agents Intensive Course Changed My Understanding of AI
- AI Email Personalization: Why Your Predictive Content Blocks Are Probably Creeping People Out
- "Teaching AI to Teach: My 5-Day Journey Building an AI Literacy Agent"
- Most startups don't fail because of code - they fail because of decisions
- How I Made Sharp 950x Faster (And Why It Matters After Bun Joined Anthropic)
- DEV Track Spotlight: Unleash Rust's Potential on AWS (DEV307)
- Building a Simple RAG System Using FAISS
- AI agents are everywhere, but what actually is an AI Agent?
- [AWS] 4. EC2 Instance Storage Section, EBS (Elastic Block Store), AMI (Amazon Machine Image), EFS (Elastic File System)
- How to build an intelligent agent that can automatically score submitted Python files and reports?
- Breaking Down the Cloud: A Simple Guide for Beginners
- Runtime environment variables in Next.js - build reusable Docker images
- Creating an AI Discord Bot with Ollama
- Production-Ready E-commerce Price Tracker API: A Xano AI Challenge Submission
- STOPSIGNAL is now available on Amazon ECS Fargate
- I Thought AI Agents Were Just Prompts. This Course Proved Me Wrong.
- Hi tech gurus - I’m building devars, a developer-focused platform for AI-assisted tooling.
- AI 브라우저를 활용한 PR 메세지 자동화
- An Intro to Large Language Models and the Transformer Architecture: Talking to a calculator
DEVOPS
FINANCIAL
- Trump Called 'Insensitive' After Posting 'Cheery' Christmas Portrait Amid 'Tragic' Brown University Shooting
- Broadcom and Costco's rich valuations leave little room for error as battleground stocks
- The hot trade: hedging against the AI bubble popping
- AI fever echoes dot-com era, but some key twists: WSJ analysis
- ServiceNow is said to prepare $7B deal for cybersecurity firm Armis
- ServiceNow in talks to acquire cybersecurity startup Armis in potential $7 billion deal, Bloomberg reports
- Chip makers upbeat on supply/demand dynamics heading into 2026: BNP Paribas
- ICE Detains Naturalised American Citizen in Minneapolis After Being Targeted for His 'Somali' Features
- Trump Claims 'High Household Bills' Problem Is a Hoax Amid Melania's $5k Velvet Blazer
- Violent Clashes Between Haitian Gangs Kills Dozens, Including a Top Viv Ansanm Leader
- 'I Need You Right Now, Pedophiles': Trump Campaign Email Sent to Epstein After His Death, Records Claim
- Is Trump Sundowning? Official Raises Eyebrows With Revelation of President's 4-Hour Sleep Routine
- Oracle racks up bullish views despite worst weekly drop in seven years
- US, UK tech trade deal at risk over disagreements - report
- Insider trades: Nvidia, Salesforce, AMD among notable names this week
- Intel said to be nearing $1.6B deal to buy AI chip startup SambaNova
- AI order from Trump might be ‘illegal,’ Democrats and consumer advocacy groups claim
- Here are 4 major moments that drove the stock market last week
GENERAL US
- Trump signs executive order to block state AI regulations - The Washington Post
- Disney invests $1B in OpenAI in deal to bring characters like Mickey Mouse to Sora AI video tool - The Washington Post
- The AI data center boom is coming for Kentucky. What will lawmakers do about it? - Louisville Public Media
- Why news organizations are suing AI companies, and what they hope to win - NPR
- Open AI, Microsoft face lawsuit over ChatGPT's alleged role in Connecticut murder-suicide - The Washington Post
- Jamie Dimon says soft skills like emotional intelligence and communication are vital as AI eliminates roles - Fortune
- Pennsylvania judge questions potential AI hallucinations in legal brief for gender-identity suit - 90.5 WESA
- President Trump Signs EO to Stop State and Local Regulation of AI - Ogletree
- Instacart and OpenAI partner on AI shopping experiences - OpenAI
- The View From Inside the AI Bubble - The Atlantic
- Fresh Concerns About AI Spending Are Rattling Wall Street - The Wall Street Journal
- Leonardo DiCaprio Says AI Can’t Be Art Because “There’s No Humanity to It” - The Hollywood Reporter
- We’re running out of good ideas. AI might be how we find new ones. - Vox
- AI masking the economy cuts both ways - Reuters
- How the U.S. Can Win the AI Race - Time Magazine
- MAGA scrambles to influence Trump's AI executive order - Axios
- Meet My Top 5 Artificial Intelligence (AI) Stocks for 2026 - The Motley Fool
- Amputees often feel disconnected from their bionic hands. AI could bridge the gap : Shots - Health News - NPR
- The future of the internet in the age of AI - Brookings
- Are Generative AI Wildlife Videos Art or Slop? We Went Looking for Answers. - Outside Magazine
- Purdue unveils comprehensive AI strategy; trustees approve ‘AI working competency’ graduation requirement - Purdue University
- Newsletter | Rubio vs. Nvidia, AI cyberdefenses, Chinese pharma risk - The Washington Post
- Questions of accuracy arise as Washington Post uses AI to create personalized podcasts - NPR
- Researchers unveil groundbreaking 3D chip to accelerate AI - Stanford Report
- Caitlin Clark and the ‘young and turnt’ bring a new vibe to Team USA - The Washington Post
- Nicolais: Artificial intelligence makes it tougher to spot fake news every day - The Colorado Sun
- AI Surveillance Startup Caught Using Sweatshop Workers to Monitor US Residents - Futurism
- Microsoft invests US$17.5 billion in India to drive AI diffusion at population scale - Microsoft Source
- Arizona city unanimously rejects AI data center after residents' outcry - Fox Business
- Broadcom tumbles 11% despite blockbuster earnings as 'AI angst' weighs on Oracle, Nvidia - CNBC
- AI tools could drive $263 billion in holiday sales. Walmart and Target are racing to get in - CNBC
- Could America win the AI race but lose the war? - Financial Times
- Exclusive / Washington Post’s AI-generated podcasts rife with errors, fictional quotes - https-//www.semafor.com
- AI race comes down to power and data centres - and China has the edge, says unicorn hunter - Yahoo Finance
- How to use Gemini Live API Native Audio in Vertex AI - Google Cloud
- Riyadh Air and IBM Partner to Launch World's First AI-Native Airline - IBM Newsroom
- AI Applications Engineer - classifiedsmarketplace.washingtonpost.com
- Hochul signs several bills into law on artificial intelligence regulations - NY State of Politics
- Critical AI Health Literacy as Liberation Technology: A New Skill for Patient Empowerment - National Academy of Medicine
- "I was forced to use AI until the day I was laid off." Copywriters reveal how AI has decimated their industry - bloodinthemachine.com
- AI Comes of Age - Columbia University Mailman School of Public Health
- How Trump’s tech advisers overcame a MAGA rebellion over AI - The Washington Post
- The AI energy challenge: How to scale responsibly and win - The World Economic Forum
- ‘Greetings, earthlings’: Nvidia-backed Starcloud trains first AI model in space as orbital data center race heats up - CNBC
- SONIA PILCER: The literary taboo of AI - The Berkshire Edge
- Artificial Intelligence - The Washington Post
- HHS Releases Strategy Positioning Artificial Intelligence the Core of Health Innovation | Insights - Holland & Knight
- Microsoft’s Mustafa Suleyman: ‘AI Is Already Superhuman’ - Bloomberg.com
- Trump's order targeting state AI laws faces political and legal hurdles - Reuters
- Don’t Panic Yet Over AI Chip Sales to China - Carnegie Endowment for International Peace
- Gavin Newsom pushes back on Trump AI executive order preempting state laws - The Guardian
- Meet My Top 5 Artificial Intelligence (AI) Stocks for 2026 - Yahoo Finance
- Purdue University Approves New AI Requirement For All Undergrads - Forbes
- The AI skills gap is really a ‘critical thinking’ gap: The Fortune 500 fears it can’t find talent with enough sharp thinking - Fortune
- This Week in DOW: Unleashing AI, Growing Australian Partnership, Breaking Ground for Future Spacecom Home - U.S. Department of War (.gov)
- Trump tech adviser David Sacks under fire over vast AI investments - NPR
- Trump’s executive order limits state regulations of artificial intelligence - PBS
- 'Godfather of AI' says CS degrees 'will remain valuable for quite a long time' — and students should still learn to code - Business Insider
- Data centers for AI could nearly triple San Jose’s energy use. Who foots the bill? - CalMatters
- More AI tools coming in days or weeks, Pentagon R&D chief says - Defense One
MAINSTREAM
- Hailee Steinfeld and NFL husband Josh Allen are expecting their first child - AP News
- Person of interest detained in fatal mass shooting at Brown University. - Reuters
- Brazilians rally against effort to soften punishment for Bolsonaro, allies - Reuters
- Google pulls AI-generated videos of Disney characters from YouTube in response to cease and desist
- Canada’s Air Force Buys Six Bombardier Jets for $547 Million - Bloomberg.com
- Hassett says Federal Reserve can reject Trump’s views if he is chair - AP News
- Stocks of private companies like OpenAI and SpaceX are being sold via invitation-only markets to the ultrawealthy before their IPOs, creating a two-tier system (Corrie Driebusch/Wall Street Journal)
- No. 1 Indiana keeps defensive coordinator Bryant Haines with new contract, AP source says - AP News
- Ukraine, US peace talks in Berlin end, to resume Monday, Zelenskiy adviser says - reuters.com
- Grok is spreading inaccurate info again, this time about the Bondi Beach shooting
- ‘Bel-Air’ had its series finale. And its TV mom says the goodbye was ‘full of gratitude’ - Los Angeles Times
- JetBlue flight near Venezuela avoids ‘midair collision’ with US Air Force tanker - AP News
- Delivery Hero Chair Kristin Skogen Lund backs CEO Niklas Östberg as the group explores asset sales amid shareholder pressure over its falling stock price (Kieran Smith/Financial Times)
- Kindle's in-book AI assistant can answer all your questions without spoilers
- Netanyahu Says Australia Failed to Protect Jews Despite Warning - Bloomberg.com
- No charges for ‘Capt. Hollywood’; detectives claim LAPD mishandled CBS exec case leak - Los Angeles Times
- Person of interest detained in Brown University shooting that killed 2 and wounded 9 - AP News
- Investors seek protection from risk of AI debt bust
- Britain's King Charles 'appalled and saddened' by shooting in Sydney - Reuters
- Nvidia's new monitoring software shows where AI GPUs are running worldwide
- Solve Intelligence, which offers generative AI tools to law firms for IP and patent law work, raised a $40M Series B, bringing its total funding to $55M (Mike Butcher/Pathfounders)
- Bundesliga Soccer Livestream: How to Watch Bayern Munich vs. Mainz
- Nvidia’s H200 AI Chip Gets a Potential Second Act in China - Bloomberg.com
- As world leaders debate AI governance, three billion people can’t even get online - Reuters
- Want job security in the age of AI? Get a state license – any state license
- New York Snow to End by Midday Before Temperatures Plummet Again - Bloomberg.com
- As gerrymandering battles sweep country, supporters say partisan dominance is ‘fair’ - AP News
- Bystander who tackled armed man at Bondi Beach shooting hailed as hero - Reuters
- Why celebrities are loving crypto again in Trump’s second term
- Australia Flags $13.3 Billion Savings as Budget Strains Grow - Bloomberg.com
- How media coverage of Trump's AI EO overstated federal authority over states and overlooked how the order's interstate commerce argument could backfire (Mike Masnick/Techdirt)
- Experts urge caution as Trump’s big bill incentivizes AI in healthcare
- Lukas Nelson on competing for a Grammy against his famous dad - Los Angeles Times
- China Vanke bondholders reject payment extension, raising default risk - Reuters
- US startup seeks to reclaim Twitter trademarks 'abandoned' by Musk’s X - Reuters
- Caitlin Clark on CBA negotiations: ‘Biggest moment in the history of the WNBA’ - Los Angeles Times
- Kremlin says NATO's Rutte is irresponsible to talk of war with Russia - Reuters
- Ukraine's Zelenskiy ditches NATO ambition ahead of peace talks - Reuters
- Thailand says Cambodian rocket fire has caused its first civilian death in new border fighting - AP News
- A profile of ASML, Europe's most valuable company, as it prepares for a transition to High NA EUV, with high-volume manufacturing expected in 2027 and 2028 (Bloomberg)
- Federal judge issues order to prohibit immigration officials from detaining Kilmar Abrego Garcia - Los Angeles Times
- Photos show Arctic air blast hitting northern US and waterlogged Pacific Northwest - AP News
- Sustainable Switch Climate Focus: Do rising temperatures cause Asia’s deadly storms? - Reuters
- Prime Security, which develops AI agents that help with security design during software development, raised a $20M Series A led by Scale Venture Partners (Chris Metinko/Axios)
- SuperCircle, which offers an AI-powered reverse logistics and recycling management service for retail brands, raised a $24M+ Series A led by Foundry Group (Duncan Riley/SiliconANGLE)
- Qargo, which offers a cloud-based transport management service for carriers, freight forwarders, and third-party logistics, raised a $33M Series B led by Sofina (Tamara Djurickovic/Tech.eu)
- To build more powerful AI systems, some AI leaders are focusing on pursuing an approach called continual learning, which mimics how people learn over time (Shirin Ghaffary/Bloomberg)
- Outset, which develops AI agents that help Microsoft and other companies conduct customer research and surveys, raised a $30M Series B led by Radical Ventures (Chris Metinko/Axios)
- Sources: OpenAI told staff it was ending the six-month "vesting cliff" that required new employees to work for at least six months before their equity vests (Wall Street Journal)
- The US CFTC withdraws its 2020 guidance on the "actual delivery" of a digital asset, aiming to support broader access to regulated crypto markets (Micah Zimmerman/Bitcoin Magazine)
- A University of Cambridge analysis reveals how cheap SMS text message verification to create online accounts fuels global influence and manipulation campaigns (Clive Cookson/Financial Times)
- Why Humanoid Robots and Embodied AI Still Struggle in the Real World : General-purpose robots remain rare not for a lack of hardware but because we still can’t give machines the physical intuition humans learn throu...
- Esusu, which offers a rent reporting API to Zillow, banks, and others to help renters build credit scores, raised a $50M Series C at a $1.2B valuation (Krysta Escobar/CNBC)
- Despite talk of an existential US-China AI race, the Chinese state and its major companies are spending more to dominate other domains, such as EVs and robotics (Tim Wu/Financial Times)
- The AI boom is delaying US municipal projects, as ~$4T in AI infra spending through 2030 shifts skilled construction workers to AI data centers (Brooke Sutherland/Bloomberg)
- Q&A with Microsoft AI CEO Mustafa Suleyman on defining superintelligence, its application in the medical field, universal basic income, regulation, and more (Mishal Husain/Bloomberg)
- Google Has Taken Down AI-Generated Content Following Disney’s Cease and Desist
- A Florida school went into lockdown after AI flagged a clarinet as a gun
- Machine learning just helped researchers create the biggest 3D map of buildings around the world
- Inside Rivian’s big bet on AI-powered self-driving
- AI data center boom could be bad news for other infrastructure projects
- Notorious 'winter vomiting bug' rising in California. A new norovirus strain could make it worse - Los Angeles Times
- Justin Herbert optimistic about hand injury heading into Chargers-Chiefs showdown - Los Angeles Times
- L.A. City Councilman John Lee violated gift laws on lavish Vegas jaunt, judge says - Los Angeles Times
- Letters to the Editor: Trump wouldn’t have to bail out farmers if he hadn't implemented tariffs in the first place - Los Angeles Times
- China Warns Against Japanese Militarism at Massacre Memorial - Bloomberg.com
- United Flight to Tokyo Returns to Dulles After Engine Fails - Bloomberg.com
- Hold hold JPMorgan Arranges Galaxy Bond Issuance on Solana Blockchain - Bloomberg.com
- Hong Kong, India Fuel Blockbuster Year for Asia Fundraising - Bloomberg.com
- AI Needs Fewer Prophets and More Predictions - Bloomberg.com
- UK police won’t probe claim former prince asked bodyguard to investigate Virginia Giuffre - AP News
- Eritrea withdraws from regional bloc as UN expresses concern over tensions with Ethiopia - AP News
- Peter Greene, a character actor known for role as the villain Zed in ‘Pulp Fiction,’ has died - AP News
- Ukraine says Russian drone attack hit civilian Turkish vessel - Reuters
- Judge says Comey evidence was wrongfully retained, creating hurdle for new charges - Reuters
- Engine failure forces United Airlines flight to return to DC-area airport - Reuters
- With Fed independence in crosshairs, will Supreme Court back Trump again? - Reuters
- Thailand declares curfew along coast as Cambodia border fighting spreads - Reuters
- Breakingviews - Small AI deflation causes high-pitch Oracle squeak - Reuters
- For the First Time, AI Analyzes Language as Well as a Human Expert
- Gavin Newsom pushes back on Trump AI executive order preempting state laws
Total Sources: 328 | Generated: 12/14/2025