AI NEWS
- AI ruined the job market, so people are using dating apps to find work
- BREAKING THROUGH Tesla AI in 2026
- China Planning Crackdown on AI That Harms Mental Health of Users
- Godfather of AI Warns That It Will Replace Many More Jobs This Year
- SweetDream Chatbot Access, Pricing, and Feature Overview
- SweetDream AI Image Generator Prices, Capabilities, and Feature Breakdown
- Sticky inflation, metal prices and the AI bubble risk: key trends to watch in the Australian economy in 2026
- 10 Lesser-Known Python Libraries Every Data Scientist Should Be Using in 2026
- The Top 6 AI Stories of 2025 : Artificial intelligence in 2025 was less about flashy demos and more about hard questions. What actually works? What breaks in unexpected ways? And wh...
- Alibaba's new open Qwen image model aims for more natural-looking results
- Managing AI Risk in Regulatory Compliance for Modern Technology Enterprises
- Engineering at Scale: From Search Systems to AI-Native Platforms and Data Products
- OpenAI's stock compensation averages $1.5 million per employee, dwarfing every tech startup in history
- Chinese AI startups beat Silicon Valley to the public markets in a massive IPO wave
- 2025 Recap: The Year the Old Rules Broke
- Meta’s next big AI bet: Manus
- Nvidia plans H200 production ramp at TSMC while China debates whether to let the chips in
- xAI snaps up Mississippi warehouse for third massive data center as Musk eyes two gigawatts of AI power
- Microsoft CEO Nadella reportedly enters "Founder Mode" to keep pace with AI rivals Amazon, Google, and Anthropic
- Nvidia reportedly in talks to acquire AI start-up AI21 Labs for up to $3 billion
- SoftBank lifts OpenAI stake to 11% with $41bln investment
- Southern California's unlikely AI mecca is this very industrial city
- Proof of Usefulness Hackathon by HackerNoon: Become an Official Ecosystem Partner
- Amid competing international regulatory regimes, UK companies have a golden opportunity to chart their own AI path
- Meta pays $3 billion for Manus AI after startup cut all Chinese ties to clear regulatory hurdles
- China's semiconductor independence push is turning US export controls into a domestic boom
- Blind Strokes and Digital Horizons: How AI Helps Me Remaster My Reality
- From Copilot to Coworker: Moving Beyond "Autocomplete" to "Autonomous Agents" in the IDE
- Who’s in Charge When AI Acts on Its Own? The Agentic AI Governance Gap
- Agent-specificity is the New Accuracy
- Stop Building AI Features Without Doing This First
- The phone is dead. Long live . . . what exactly?
- Ahead of CES 2026: Cameras and Maker Tools May Be Turning Into Software Businesses
- Instruction Tuning and Custom Instruction Libraries: Your Model’s Real ‘Operating Manual
AI RESEARCH
- The $14 vs $2 Plot Twist: Why GLM-4.7 Just Broke the AI Leaderboard
- The ML Evaluation Math You Can Actually Trust
- Why Likelihood Fails for Continuous LLMs — and How CALM Solves It
- A Practical Guide to Building RAG Systems: Series Introduction
- The Truth About LLM Evals: Why Your AI Model Might Be Better (or Worse) Than You Think
- The Ghost Teacher: Why Yann LeCun Says “Generative” AI might be a Dead End
- Engineering Trustworthy Enterprise AI with Geometry and Physics: The Semantic Gravity Framework
- I Thought Private Variables Were Actually Private (Then I Accessed Them From Outside the Class)
- Scaling Inference for Generative AI: From Bottleneck to Business Enabler
- This Python Package Makes Differentiable Physics Simulations Practical
- More than half of new articles on the internet are being written by AI
- Benchmarking Zero‑Shot Object Detection: A Practical Comparison of SOTA models
- The $18/Hour Hacker: How AI Redefined the Economics of Cyber Attack
- Presentation: Lessons Learned From Building LinkedIn’s First Agent: Hiring Assistant
- Adapting Your Data Platform to the Agent-Native Era
- Master Pandas Performance with Python: 7 Lessons Every Junior Data Scientist Needs
- Training the Same Neural Network with Different Optimizers
- The Sequence AI of the Week #781: The Amazing GLM 4.7
- Kubernetes 1.35 Released with In-Place Pod Resize and AI-Optimized Scheduling
- Cloudflare Year in Review: AI Bots Crawl Aggressively, Post-Quantum Encryption Hits 50%, Go Doubles
- LLM & AI Agent Applications with LangChain and LangGraph — Part 11: Tools
- Text Summarization: Comprehensive Overview with and without RAG
- How I Built a Chatbot Without APIs, GPUs, or Money
- Build Your Own Dedicated Stock Analysis AI Agent for Free with DefeatBeta API + MCP + LLM
- How I Built a Chatbot Without APIs, GPUs, or Money (Part 2)
- LLM & AI Agent Applications with LangChain and LangGraph — Part 8 — temperature, top-p, top-k and…
- LLM & AI Agent Applications with LangChain and LangGraph — Part 9 — Conversation memory
- LLM & AI Agent Applications with LangChain and LangGraph — Part 10- Chains and LCEL
- What Makes a Career in Data Science Future-Proof in the Age of Automation
AI TOOLS
CLOUD BUSINESS
- Is Neovim Your Next Favorite Development Tool?
- SAFE-MCP, a Community-Built Framework for AI Agent Security
- Can one state save us from AI disaster? Inside California's new legislative crackdown
- Amazon is selling the Meta Quest 3S for as low as $250 (and it comes with a free $50 credit)
- Puppy Linux vs. Linux Lite: Which distro is right for your old Windows 10 PC?
- How AI Will Help Tomorrow’s IT Operations
- The AI balancing act your company can't afford to fumble in 2026
- Getting DNS Right: Principles for Effective Monitoring
- How I use Samsung's secret Wi-Fi menu to seriously improve my connectivity
- This hidden Pixel camera feature makes your photos more vibrant - how to enable it
- This fully atomic Linux distro is a challenge to install but a treat to use
- I recommend bringing these 6 wellness gadgets into 2026 - here's why
CLOUD SECURITY
- Communicating AI Risk to the Board With Confidence | Kovrr
- Real-World Cyber Attack Detection: How Modern SOCs Identify, Block, and Contain Advanced Threats
- SHARED INTEL Q&A: Why Data Bill of Materials (DBOM) is surfacing as a crucial tool to secure AI
- Best of 2025: News alert: SquareX research finds browser AI agents are proving riskier than human employees
- Why Visibility Alone Fails and Context Wins in 2026
- How AI Helps Recover Both Technical Dept & Innovation Debt?
CLOUD TECHNICAL
- Teaching Machines the Art of Nuance with Google Cloud Natural Language API
- Elevating Crypto Communities: How I Combined Discord and AI for Real-Time Market Intelligence 📊🤖
- 🔑 OAuth Explained Like You're 5
- [Launched] Generally Available: Cloud-native apps on Kubernetes pricing calculator scenario
- [Launched] Generally Available: Azure Premium SSD v2 Disk is now available in Austria East and in a second Availability Zone in Japan West
- ROI de agentes: hype ou realidade? (último do ano de 2025)
- Monitoring Third-Party Webhook Delays with AWS Durable Functions
- Deepfake & Mobile Identity Fraud - Securing AI Models with Docker
- Build Robust, Maintainable APIs in C# - Real Production Systems
- A Token-Efficient Way to Send Time-Series Data into LLMs
- When an AI refactor renames things wrong across files
- My parting gift to 2025 - my Claude Code context workflow turned into a plugin
- AutoGluon-Tabular: Robust and Accurate AutoML for Structured Data
- I'm 15 and I built a self-healing AI terminal that controls computers via Natural Language
- Cloud Computing: Powering the Digital World from Anywhere
- Machine Learning - Model Deployment - Complete Tutorial
- FRD Orchestration with MCP: Deterministic Context Control for Agents (No Drift)
- Building a Matrix Digital Rain Screensaver for Windows 10/11
- An Algebraic View of Databases
- The Kubernetes Explanation I Wish I Had as a Junior ☸️
- AWS Serverless Guide: Securing IoT Data Ingestion with API Gateway, Lambda, and DynamoDB
- Scaling Django on Railway + S3 + Cloudflare for 1k+ concurrent users
- AI-Powered Real-Time Egyptian Sign Language Translator
- 🚀 From Chaos to Orchestration: Mastering Azure DevOps CI/CD Pipelines [Week-9] ⚙️
- I Built an AI Tarot Reading Tool That Goes Deeper Than Just Card Meanings
- When Architecture Inverts Complexity - How CQRS and Event-Driven Architectures Undermine Scalable Domain Models
- 2025: The Year AI Became My Coding Partner
- Skyflo: AI agent for Cloud & DevOps
- What do we need to build explainable AI systems for the medical domain?
- Cloudflare + MongoDB: How to fix 'Error: Dynamic require of "punycode/" is not supported'
- Deploying Scalable Web Apps With Azure App Services
- Building Single-Executable Node.js Apps (Without the Pain)
- Hashicorp Vault: Fine-Grained Access Control with Policies
- MCP Security 101: Protecting Your AI Agents from "God-Mode" Risks
- When AI Remembers Everything
- Java Thread Pools Explained with End-to-End Examples (Fixed, Cached, Single, Scheduled)
- How AI Sees Images: A Gentle Introduction to Convolutional Neural Networks
- SLMs vs. LLMs : Why Bigger Isn’t Always Better for Logistics & Supply Chain Intelligence
- Boost Developer Revenue: How Monetzly Makes AI Monetization Simple
- Building a Splunk Investigator Agent with Strands Agents and Amazon Bedrock AgentCore
- Generative AI Development Services: Build Intelligent AI Solutions with Oodles
- Weeks 7-8: Browser-Based AI, Holiday Dips, and Why Third-Party SEO Tools Are Nearly Useless
- AI Prevents Organized Human-Led Cyber Attacks
- When the AI Misreads the Stack: How Models Misinterpret Error Traces
- Monetzly: The Future of AI Monetization for LLM Apps
- Unlimited Free Multilingual Voice Clone: How AI Voice Replication Scales Audio Content
- Unlocking the Potential of Cloud Native App Development
- When an AI Refactor Renames the Wrong Things: A Tale of Inconsistent Function Naming
- The Future of Enterprise IT: AI-Driven Infrastructure Optimization
- Reducing False Positives in WAF: Combining OWASP Rules with AI Context
- Boost Developer Revenue with Monetzly's AI Conversation Solutions
- Kubernetes and scalability
- Why Conversational AI Is Not Just a Chatbot — It’s a Service Redesign
- AI Layer Split: Extract 5+ Game-Ready Assets Fast
- Mythical avatar app created using gogle ai studio
- Boundary Blindness: Why LLMs Struggle with Encapsulation and Scope
- XPath 완벽 가이드 - XML 문서 탐색의 모든 것
- Ruby 블록과 Lambda
DEVOPS
ENTERPRISE TECH
- The Year in Review - the year in omni-channel retail : Retailers were, inevitably, on the cusp of the AI hype cycle throughout 2025 - but there were other things going on in the sector...
FINANCIAL
- Maduro Continues Refraining To Address U.S. Attacks On Venezuelan Soil: 'Yes Peace Forever'
- Venezuelan Officials Reportedly Claimed U.S. Was Behind Strike Against Alleged Cartel Infrastructure Despite Maduro's Silence
- Against Wind Farms: Trump Uses Israel Bird Photo to Attack US Wind Farms, Humans and Birds Pay Price
- Elon Musk Slams Noah Schnapp's Stranger Things Scene As 'Unnecessary', Fans Praised 'Special' Performance
- Trump Sends 'Creepy' Fundraising Email About Needing Donations Due To 'Woke Mind Virus' Infiltration
- Alex Jones Claims Trump Family Faces Indictment Over Bitcoin, Sources Confirm DOJ And FBI Fears Over Future Sacks
- Micromem announces proposed private placement
- Space and defense boom lifted these satellite stocks by more than 200% in 2025
- Google wraps up best year on Wall Street since 2009, beating megacap peers as AI story strengthens
- Zelensky to Trump: Come to Ukraine and Help 'End the War'
- Taiwan Semiconductor granted annual approval to export chip making products to China: report
- Tech Voices: Burry on Tesla, Nvidia chip demand, Trump phone delays
- Nvidia, AMD likely to make headlines at CES amid 'AI Revolution,' Wedbush says
- Palantir outperforms bulk of enterprise software stocks during 2025
- Apple teases 'big plans' for Fitness+ subscription in 2026
- Nvidia bucks trend as chip stocks mostly lower to end year
- Trump-Kennedy Center To Ring In The New Year With Epstein Dancers? South Park Writer Trolls Trump With Domain Purchase
- Stock Market 2025 Wrapped: AI Boom Carries Major Indexes to Record Year As Experts Warn of Whats to Come
- Neuromorphic Chips and 'Brain‑Like' Computing: How Next‑Gen Chips May Change Phones, Robots, and IoT Devices
- Donald Trump Florida Visit: Taxpayers Allegedly Foot $3.4M Golf Bill While Zelensky Waits
- Riot Platforms announces agreement for up to $500M at-the-market stock offering
- Tower Semiconductor downgraded to Neutral due to valuation: Wedbush
- 'You Are Being Lied To': Cabot Phillips Fires Back at Candace Owens Over Arizona Military Base Claims
- Producer Claims Rebel Wilson's Minions Used 'Vindictive Smear Campaigns', 'Ghislaine Maxwell' Slur In Row
- Joe Rogan Slammed for Calling Measles 'Harmless' as Experts Warn of Dangerous Misinformation
- Trump Sparks War Panic as Dementia Fears Grow Over Vague Venezuela Strike Claim
- Trump Freezes Minnesota Childcare Cash Following $9B Fraud Claims: 'We Have Turned off the Money Spigot'
- US Judge Allows ICE Access to Medicaid Records, Democrats 'Disappointed' With the Ruling
- Nvidia said to approach Taiwan Semi to boost H200 production amid China surge: reports
- GlobalFoundries in focus as Wedbush downgrades on longer downturn than anticipated
- Nano Labs continues to increase BNB holdings to over 130,000 BNB; shares up nearly 12%
- How $160 million worth of export-controlled Nvidia chips were allegedly smuggled into China
- 5 themes that defined business and markets in 2025: Morning Squawk
- 'Big Short' investor Michael Burry says he's not shorting Tesla
- China accuses Netherlands of making 'mistakes' over chipmaker Nexperia
GENERAL US
- How to avoid getting into trouble when using AI at work - CNN
- Caterpillar’s Surging Stock Is Fueled by AI, Not Yellow Excavators - The Wall Street Journal
- AI slop and brainrot content now make up 1 in 2 YouTube Shorts recommendations, study reveals - Mashable
- Goldman Helps Lead Financing for 5-Gigawatt Texas AI Power Sites - Yahoo Finance
- If U.S.-China AI Rivalry Were Football, the Score Would Be 24-18 - The Wall Street Journal
- Future of D.C. golf courses uncertain as Trump administration terminates lease - The Washington Post
- Scared of artificial intelligence? New law forces makers to disclose disaster plans - CalMatters
- AI-Proof Your Career In 2026: Make AI Your Ally, Not Your Enemy - Forbes
- What Are Companies Actually Doing With AI? Our Reporters Talk It Out - The Wall Street Journal
- 8 AI Research Papers Published In 2025 That Every Educator Should Read - Forbes
- Army stands up AI, machine-learning career field for officers - Military Times
- Queen Camilla says she was assaulted on a train as a teenager - The Washington Post
- Musk's xAI buys third building to expand AI compute power - Reuters
- Nine Predictions For The Music Industry In 2026: How AI Reshapes Licensing And Power - Forbes
- Meta buys startup Manus in latest move to advance its artificial intelligence efforts - ABC News
- We asked a humanoid robot if there is an AI bubble. Here's what it said - CNBC
- New laws in 2026 target AI and deepfakes, paid leave and rising Obamacare premiums - NBC News
- Nvidia Becomes a 'Must Own' Stock as AI Boom Fuels 35% Upside Potential - Yahoo Finance
- Do you think you can tell an AI-generated face from a real one? - Live Science
- 4 of the Strangest AI Moments in 2025 - Time Magazine
- Street analyst reveals 3 AI stocks set to dominate 2026 – plus, Meta’s next move - CNBC
- These companies say AI is key to their four-day workweeks - The Washington Post
- The 5 Best Names to Play AI in 2026, According to Wall Street’s Loudest Tech Bull - Barron's
- These companies say AI is key to their four-day workweeks
- A wave paralysed me but AI could help me walk again
- AI Supercluster Technician - classifiedsmarketplace.washingtonpost.com
- Poland urges Brussels to probe TikTok over AI-generated content - Reuters
- IBM Became an AI Powerhouse in 2025 - The Motley Fool
- China's Zhipu AI launches US$560 million share sale as Hong Kong's IPO tech race heats up - Yahoo Finance
- Leveraging insights from neuroscience to build adaptive artificial intelligence - Nature
- Apple needs to deliver an AI-charged Siri so good it gets older iPhone users to upgrade - CNBC
- 8 AI Books Published In 2025 That Every Educator Needs On Their Shelf - Forbes
MAINSTREAM
- Macron: allies will make commitments on protecting Ukraine at Jan 6 meeting - Reuters
- Berkshire falls on Buffett's last day as CEO, gained 6,100,000% over 60 years - Reuters
- Brookfield to start cloud business amid AI frenzy, The Information reports - Reuters
- Thiel Capital opens an office in Miami, as Peter Thiel and others reportedly look to cut ties with California over a proposed ballot measure to tax billionaires (Biz Carson/Bloomberg)
- Latest deep-sea search for missing Malaysia Airlines Flight 370 gets underway - Los Angeles Times
- India Sees Strong Growth, Vows Buffers Against Global Volatility - Bloomberg.com
- ‘Jujutsu Kaisen Modulo’ Is Better Than the OG Manga Series
- Instagram chief: AI is so ubiquitous 'it will be more practical to fingerprint real media than fake media'
- Cary Elwes channels 'Princess Bride' in a final farewell to Rob Reiner: 'Life is pain without you' - Los Angeles Times
- Fatal Machu Picchu Train Wreck Involves Units of LVMH, Carlyle - Bloomberg.com
- Filing: Chinese AI chip startup Biren raises ~$717M in its Hong Kong IPO; institutional and retail tranches were oversubscribed ~26x and ~2,348x, respectively (Himanshi Akhand/Reuters)
- Unsealed documents detail a US operation that stopped the alleged smuggling of $160M worth of Nvidia H100 and H200 GPUs to China between Oct. 2024 and May 2025 (CNBC)
- Trump Fails to Deliver on Promise of $500 Gold Phone in 2025. Could We See It Next Year?
- Pratt & Whitney settles antitrust lawsuit over engine sales - Reuters
- France aims to ban under-15s from social media from September 2026, Le Monde reports - Reuters
- Here we go again: Retiring coal plant forced to stay open by Trump Admin
- US Labor Board Abandons One of Its Cases Against Musk’s SpaceX - Bloomberg.com
- New Year’s Day: What’s open? Retailers. What’s closed? Government and Banks. - AP News
- In Ukraine, an Arsenal of Killer A.I. Drones Is Being Born in War Against Russia
- Trump Media, owner of Truth Social, plans to distribute a new token to shareholders with partner Crypto.com, expected to operate on the Cronos blockchain (Emily Nicolle/Bloomberg)
- Investors predict AI is coming for labor in 2026
- China stages military drills around Taiwan to warn 'external forces' after U.S., Japan tensions - Los Angeles Times
- KKR Bid to Take Yomeishu Private Is Derailed By Top Shareholder - Bloomberg.com
- Senator Warren Praises Decision Forcing Vought to Fund CFPB - Bloomberg.com
- Watch Why AI in Africa Depends on Telecom Infrastructure - Bloomberg.com
- Roberto Carlos reportedly undergoes heart surgery while on vacation in Brazil - AP News
- China’s Xi hails nation’s technological progress and renews promise to take back Taiwan - AP News
- US weekly jobless claims fall to 1-month low - Reuters
- Wall Street slips as tech continues to weigh, but nears annual gains - Reuters
- iOS 27 Is Expected to Bring Health+, Foldable Optimizations, and More AI
- Supply chains, AI, and the cloud: The biggest failures (and one success) of 2025
- Every fusion startup that has raised over $100M
- What I Want to See From AI in 2026: Labels, Better Phone Features and a Plan for the Environment
- The best cross trainers for a low-impact workout at home, tested
- L.A. City ignored fire safety as it permitted development in high risk areas, lawsuit alleges - Los Angeles Times
- US Jobless Claims Fall to 199,000 During Christmas Week - Bloomberg.com
- Channel Tunnel power malfunction fixed, but rail delays may linger - AP News
- Latest deep-sea search for missing Malaysia Airlines Flight 370 gets underway - AP News
- NASA Telescopes Capture Colliding Spiral Galaxies in Sparkling Detail : Astronomers combined data from NASA’s JWST and Chandra X-ray Observatory to create a stunning new image of two merging spiral galaxies
- From prophet to product: How AI came back down to earth in 2025
- Delhi’s Worst Air in Years Fuels Anger in Test for Modi’s Party - Bloomberg.com
- Indonesia raises alert for the Mount Bur Ni Telong volcano following a spike of activity - AP News
- What to know about the mystery of Malaysia Airlines Flight 370 as the search resumes - AP News
- China announces it ‘successfully completed’ Taiwan military maneuvers - AP News
- Exclusive: Drugmakers raise US prices on 350 medicines despite pressure from Trump - Reuters
- Tell us: have you trained your AI job replacement?
- How the AI data center boom boosted Caterpillar's power and energy unit; generator sales are up 28% YoY through Sept. 2025, after growing 22% to $7.8B in 2024 (Bob Tita/Wall Street Journal)
- 2025 Was the Year AI Slopified All Our Gadgets
- The Year Ahead in AI: Ads, IPOs and Moving Beyond LLMs - Bloomberg.com
- Russian drones blast Ukraine’s Odesa and injure 6, including children - AP News
- Four injured, including three children in Russian attack on Odesa, Ukraine says - Reuters
- China's CXMT eyes $4.2 billion Shanghai listing to fund DRAM expansion - Reuters
- AI-Powered Dating Is All Hype. IRL Cruising Is the Future
- A 2025 recap for Tech & AI
- I'm Done Letting Stress Win. These 7 Simple Daily Habits Are My Secret Weapon for Happiness
- Copper Set for Biggest Annual Gain Since 2009 on Supply Bets - Bloomberg.com
- Nigeria complete perfect group campaign with 3-1 win over Uganda - Reuters
- Filing: China's top DRAM maker CXMT plans to raise $4.2B in a Shanghai IPO; CXMT held a 4% global share in Q2 2025 and targets HBM production by the end of 2026 (Reuters)
- Watch Starfighters CEO Says Looking to Add Spaceport, Aircrafts - Bloomberg.com
- Filing: Chinese chip designer OmniVision Integrated Circuits seeks to raise up to ~$617M in a Hong Kong IPO; HKEX: Hong Kong IPOs have raised ~$36B in 2025 (Sneha Kumar/Reuters)
- Chinese AI firms are leading a wave of IPOs in Hong Kong, where at least 25 companies debuted in December 2025, the busiest month for deals since November 2019 (Jeanny Yu/Bloomberg)
- OpenAI financial data: its stock-based pay averaged ~$1.5M per employee in 2025, ~7x Google pre-IPO and ~34x the average pay of other pre-IPO peers, per Equilar (Wall Street Journal)
- Golf is a family affair for Steve Stricker’s family and that includes wife Nicki - AP News
- Russia's Gerasimov says Putin ordered Ukraine buffer zone expansion in 2026 - Reuters
- Sources: bids for GroqCloud, Groq's AI inference platform, are expected to exceed $1B after Nvidia's $20B non-exclusive licensing agreement with Groq (Kate Clark/Wall Street Journal)
- AI forecast to put 200,000 European banking jobs at risk by 2030
- Can AI really help us find love?
- Nursing home bailouts. Why Vermont has given millions to keep care centers afloat - AP News
- Filing: Chinese chipmaker GigaDevice aims to raise up to ~$600M in a Hong Kong IPO, offering 28.9M shares at up to ~$21 each (Nichiket Sunil/Reuters)
MARKETING STRATEGY
MARKETING TECH
SECURITY
Total Sources: 285 | Generated: 12/31/2025